X   Сообщение сайта
(Сообщение закроется через 3 секунды)



 

Здравствуйте, гость ( Вход | Регистрация )

Открыть тему
Тема закрыта
> Как удалить ссылку в плагине?, Не знаю какую именно ссылку удалить
protasov7
protasov7
Topic Starter сообщение 25.11.2011, 20:31; Ответить: protasov7
Сообщение #1


Бывалый
****


Группа: Banned
Сообщений: 300
Регистрация: 17.8.2010
Из: Россия
Поблагодарили: 16 раз
Репутация:   -16  


Здравствуйте.
Есть следующая проблема.
Для того чтобы добавить сайт в сапу установил в своем WordPress плагин iSape, Версия 0.72 (02-05-2010) | Автор: Itex
В общем теперь есть следующая заморочка. На каждой странице отображается ссылка http://itex.name/isape
Количество ВС (1) в базе и на странице совпадает.
Я еще не начал ссылки продавать а тут эта ссылка мне хочет отбрать 30% моих доходов.
Я так понял что ссылка сквозная. Смотрю на сайте и правда в сайдбаре новый блок появился где должны отображаться проданные ссылки а если кликнуть на название блока (I sape называется) то попадаешь на сайт http://itex.name/isape.
Меня это никак не устраивает.
Думаю что можно этот урл удалить из кода плагина



Развернуть/Свернуть



<?php
/*
Plugin Name: iSape
Version: 0.72 (02-05-2010)
Plugin URI: http://itex.name/isape
Description: SAPE.RU helper. Plugin iSape is meant for the sale of conventional and contextual links in <a href="http://www.sape.ru/r.a5a429f57e.php">Sape.ru</a> .
Author: Itex
Author URI: http://itex.name/
*/

/*
Copyright 2007-2009 Itex (web : http://itex.name/)

This program is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation; either version 2 of the License, or
(at your option) any later version.

This program is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.

You should have received a copy of the GNU General Public License
along with this program; if not, write to the Free Software
Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
*/

/*

EN
Plugin iSape is meant for the sale of conventional and contextual links in Sape.ru.
Features:
Support for both conventional and contextual links.
Placing links up to the text of page, after page of text in the widget and footer.
Widget course customizable.
Automatic installation of a plug and the rights to the sape folder on request.
Adjustment of amount of displayed links depending on the location.

Requirements:
Wordpress 2.3-2.6.3
PHP5, PHP4
Widget compatible theme, to use the links in widgets.

Installation:
Copy the file iSape.php in wp-content/plugins .
In Plugins activate iSape.
In settings-> iSape enter your Sape Uid.
If you want to create a Sape folder automatically, coinciding with your Sape Uid.
Allow work Sape links, to specify how many references to the use of text after text, widget and footer.
Allow Sape context.
If you are adding content frequently , then content links of main page, tags and categories can return error.
If you frequently add content, the content of the main links, tags, categories can fly out in error.
For preventation of it switch on the option "Show context only on Pages and Posts".
As required switch on Check - a verification code.
For activating widget you shall go to a design-> widgets, activate the widget iSape and point its title.
If define ('WPLANG', 'ru_RU'); in wp-config.php then russian language;

RU
Плагин iSape предназначен для продажи обычных и контекстных ссылок в Sape.ru
Возможности:
Поддержка как обычных, так и контекстных ссылок.
Размещение ссылок до текста страницы, после текста страницы, в виджетах и футере.
Виджет конечно настраиваемый.
Автоматическая установка плагина и прав на папку сапы по желанию.
Регулировка количества показываемых ссылок в зависимости от места расположения.

Требования:
Wordpress 2.3-2.6.1
ПХП5, ПХП4
Виджет совместимая тема, если использовать ссылки в ввиджетах.

Установка:
Скопировать файл iSape.php в wp-content/plugins/ вордпресса.
В плагинах активировать iSape.
В настройках->iSape ввести ваш Sape Uid.
По желанию создать автоматом папку Сапы, совпадающей с вашим Sape Uid.
Разрешить работу Sape links, указать сколько ссылок использовать до текста, после текста, в виджете и футере.
Разрешить Sape context.
Если часто добавляете контент, то контентные ссылки в главной,тегах,категориях могут вылетать в эррор.
Для предотвращения включите опцию "Show context only on Pages and Posts".
По мере надобности включить Check - проверочный код.
Для активации виджета нужно зайти в дизайн->виджеты, активировать виджет iSape и указать его заголовок.
Если define ('WPLANG', 'ru_RU'); в wp-config.php, то будет русский язык.

*/
class itex_sape
{
var $version = '0.72';
var $full = 0;
var $error = '';
//var $force_show_code = true;
var $sape;
var $sapecontext;
var $links = array();
var $tnx;
//var $enable = false;
var $sidebar = array();
var $sidebar_links = '';
var $footer = '';
var $beforecontent = '';
var $aftercontent = '';
var $safeurl = '';
var $document_root = '';
//var $debug = 1;
var $debuglog = '';
var $memory_get_usage = 0; //start memory_get_usage
var $get_num_queries = 0; //start get_num_queries
//var $replacecontent = 0;

/**
* constructor, function __construct() in php4 not working
*
*/
function itex_sape()
{
if (substr(phpversion(),0,1) == 4) $this->php4(); //fix php4 bugs
add_action('widgets_init', array(&$this, 'itex_s_init'));
//add_action("widgets_init", array(&$this, 'itex_s_widget_init'));
add_action('admin_menu', array(&$this, 'itex_s_menu'));
add_action('wp_footer', array(&$this, 'itex_s_footer'));
$this->document_root = ($_SERVER['DOCUMENT_ROOT'] != str_replace($_SERVER["SCRIPT_NAME"],'',$_SERVER["SCRIPT_FILENAME"]))?(str_replace($_SERVER["SCRIPT_NAME"],'',$_SERVER["SCRIPT_FILENAME"]))sad.gif$_SERVER['DOCUMENT_ROOT']);

}

/**
* php4 support
*
*/
function php4()
{
if (!function_exists('file_put_contents'))
{
function file_put_contents($filename, $data)
{
$f = @fopen($filename, 'w');
if (!$f) return false;
else
{
$bytes = fwrite($f, $data);
fclose($f);
return $bytes;
}
}
}
$this->itex_debug('Used php4');
}

/**
* Russian lang support
*
*/
function lang_ru()
{
global $l10n;
$locale = get_locale();
if ($locale == 'ru_RU')
{
$domain = 'iSape';
if (isset($l10n[$domain])) return;
///ru_RU lang .mo file
$input = 'eNqdVl1sFNcVvm3AhjVrQ5o2f017nTQJhK7XJ' . 'hDIkFaxwWlQQayw06TkwZ3dufZOvMxsZsbgTaQq
NhASBQGlDYnSIIoUqVIfKscY2KyJeUmal0qdfUilSFXbh0pVWqntW9SHSv3OPXd/bC' . '84yaL1t+f3nnv+Ln++ddXrAp9t+H4T3w++IsQPgIVbhP68skqINuCrwATwDLAT+Evg3cDfGPp3wK
8B
PwZ2AT8F3gb8r5F3rhaiA3gP8BvATcA7gY8b+iDw68DnV/N5J4DtwFOGPge8A3geuAZ' . '4xcivA+8FfgS0gP8ASuD9bYxPtPG9xoDfBh4z+A5wHd23jf1UgUngJ0C6+t/bON5/Gv5nhl4N5XuAG9rZPg28H/hYO+tl2zm+osGS4U+' . '3cx7OtPN5F/BnPfDXhl82+JHR/2M7x/k3c86qNZyvDWtYb/MarocF7EfNBg3/xFqO79xa9j8H3AT8cC3n4d/AjcB1Cc77tgTnb2+C/fvA26newO3AiwnO6yfAB4C3dfB9dwI3AO0OPifs4POPAXcAfw68Ffh7I/8L8FHgf4AZ4E' . 'O41CPAFw3OrmP5p4a+L8l4MMlx/yzJ+f9tkvuqkmS/f0jyPf5q8LMkn9vZyf66OzneZ4EHgVOd3Bd/6uQ+/V8n5zvZxf18dxfnY3sX+z/Yxf7GDf' . '3TLr73aUNfBO6k+Lv4/v8CPkh+gXdRH65n/ceBKJM+k+r5LR4vfbe0aHyoN0gfZdL9Iw2f7rxZcKzUF1Sr9Ua2le4pOM57DY/O7hM8k7UPzTj1Ro/' . 'gnNyH73ea5A/h+13qNUPTfTrMb5rNhPlN99vYZEfz2YvvV5t4NEPUL1sE9xPllub3YSNP0SwJswuI0Z+L3M' . 'NK9DsyLPi
RdB38DJUXKjlQ8HPjsk7ucaQHBUeNup5yHssG6e+L/tFIBXKX70XKiyxD5piUBdcbD8W' . 'AGvUD1dAx9BIlfVTRD93I9T1Dhu4LSopdtveTSOYCZUdKDtlFJR036
F7MHvYm08/YxRaSEAY9xXxxCXvSLhpuXuXGLaGjm4zELi0Wu91A2p5TUzNWTjcEoZ0t' . 'KEcMejWkG5f8iUDqPOWQp93
S9WSUd0OZ9Sd7mlUG1NiEJ+2JyJdF21miKTdmSTxC4hGINy0yHerPDMqnFlt0r6SwyEM' . '+OlS4oTDyJm/qvYW8Rzzh+6TAJWTCEk/yMaEKotAS++xJkfGPqEA5MluSQhcwx9m2mNLm/Nsxea9VrZH4Ifsweihve2MqFEN5/0jNifS9Qgl/ZMa' . 'GSFtn/DAKe8SQ66isXQvPUJb4kQpC9JglnnadMRVJ0/+GGnajgrKkeNoPxl1vTPy4XlmagN0WM2q5NqSuW0NqcmWJEdIbeWpo8IC0C7iJU1o8PW' . 'xnxsw4aTFk7j
7fUyW5v0izEQpyb3KWCfznVC5K7XFStWvJRGb/cEr3McjUbqRP81IH1GE3bLC29PbuSPVt' . 'SfVtlX3bra2PbO7d1tub2GuHUWo4sL2wYEd+YEkXOQbXG5tA
elPDyj4Eb/v27BtsHNjX05sw050aLhXhm+qSLhZs19spc3k7CFX0vYloNLWjoUdHjKogNejlf' . 'AeJtuSOrBslnkllfH
RBlPqhKh3xAyfc64aRJUdGGpIBO1RFO8pbMp33D6n0uAqypTDdl3YPUZoaikPKDnL5DFR' . 'TvTdSFvGZuF
K
djsvxbPx+vCDiNwFz8eX4fWJWj0FQiWfwe6H6UmMTxu/G8/FCXGlejbC7LKtHq1NQniFf8D' . 'hPjriG8QW4mCKOhMcF7Z9PmbFEfBFmr0FYicsyvn5DTRH/Il5Y0X6uhY4+P76KK72M7+n6DUjyK8R7Nb4WX8YVm/nnKYJroC5Vj0pERPZzlIzqSd7DoM' . 'rVl3BEhRME6lT3ze1qixoX+aKmjU1+U7X6Zo8vwC1VAfeiCyFNb9
WTUqE6IW/NpqJFUMhUWaINZuL34vn6c9A4Eu5ew1Fnkf1KPF89VT1BGadGOrucgVB0yqY' . 'p/Fkc+krTZgFHl54LP4t/C3QAVlFry+VPSWsHLV6V1g7r70drP91fzmz5aWe1mX4ldJfOfW5LPrD+FH2xOFcw61kyRLOoOqZ5Wn' . 'fP
ZRG/UyPMAxfPmkmfJX301tv4ja7CwrhWPRpfo01yNb6ENppurAK0AQ9OZXEjmocQP+sRWCt3Y/2RXNaOaOvqcVjQHirrqUBYesRpS2nmad4IFZp9nDlrpmdpZFKHP189SQLacTM' . 'SeZqu+34ZdscpKt5vlJ
Hq8eWpnNIhz2G7zHA6LzYzLCoZUkvZq57WVBmyK+BNS51WXtCIXMRvgHFJl29B164im' . '9X1mNNCe1dnfo
Z
4wrRc8ytuWI133DCanvIap9Vrjgpfofa5rldM2aSijPPmdabLZvXM1NY/T2v93RiovfUrv' . 'RrnEcOUzvcC8kXpNP8Z0P8LWNww/wfAETHC';
$input = gzuncompress(base64_decode($input));
if (file_exists(ABSPATH . WPINC . '/streams.php') && file_exists(ABSPATH . WPINC . '/gettext.php'))
{
include_once(ABSPATH . WPINC . '/streams.php');
include_once(ABSPATH . WPINC . '/gettext.php');
$inputReader = new StringReader($input);
$l10n[$domain] = new gettext_reader($inputReader);
$this->itex_debug('Used Ru language');
}
}
}

/**
* Debug collector
*
*/
function itex_debug($text='')
{
$this->debuglog .= "\r\n".$text."\r\n";
}

/**
* plugin init function
*
* @return bool
*/
function itex_s_init()
{
if ( function_exists('memory_get_usage') ) $this->memory_get_usage = memory_get_usage();
if ( function_exists('get_num_queries') ) $this->get_num_queries = get_num_queries();

//echo $this->get_num_queries;//die();


if (get_option('itex_s_global_masking')){
$this->itex_s_safe_url();
$last_REQUEST_URI = $_SERVER['REQUEST_URI'];
$_SERVER['REQUEST_URI'] = $this->safeurl;

}
$this->itex_debug('REQUEST_URI = '.$_SERVER['REQUEST_URI']);


$this->itex_init_sape();

$this->itex_s_widget_init();
if (strlen($this->footer)) add_action('wp_footer', array(&$this, 'itex_s_footer'));

//echo get_num_queries();die();

if ((strlen($this->beforecontent)) || (strlen($this->aftercontent)) )
{
$this->itex_debug('strlenbeforecontent = '.strlen($this->beforecontent));
$this->itex_debug('strlenaftercontent = '.strlen($this->aftercontent));
add_filter('the_content', array(&$this, 'itex_s_replace'));
add_filter('the_excerpt', array(&$this, 'itex_s_replace'));
}

if (isset($last_REQUEST_URI)) //privodim REQUEST_URI v poryadok
{
$_SERVER['REQUEST_URI'] = $last_REQUEST_URI;
unset($last_REQUEST_URI);
}

if ( function_exists('memory_get_usage') ) $this->itex_debug("memory start/end/dif ".$this->memory_get_usage.'/'.memory_get_usage().'/'.(memory_get_usage()-$this->memory_get_usage));
if ( function_exists('get_num_queries') ) $this->itex_debug("get_num_queries start/end/dif ".intval($this->get_num_queries).'/'.intval(get_num_queries()).'/'.(intval(get_num_queries())-intval($this->get_num_queries)));
return 1;
}

/**
* sape init
*
* @return bool
*/
function itex_init_sape()
{
if (!get_option('itex_s_sape_enable')) return 0;
if (!defined('_SAPE_USER')) define('_SAPE_USER', get_option('itex_s_sape_sapeuser'));
else $this->error .= '_SAPE_USER '.__('already defined<br/>', 'iSape');
$this->itex_debug('SAPE_USER = '.get_option('itex_s_sape_sapeuser'));
//FOR MASS INSTALL ONLY, REPLACE if (0) ON if (1)
// if (0)
// {
// update_option('itex_sape_sapeuser', 'abcdarfkwpkgfkhagklhskdgfhqakshgakhdgflhadh'); //sape uid
// update_option('itex_sapecontext_enable', 1);
// update_option('itex_sape_enable', 1);
// update_option('itex_sape_links_footer', 'max');
// }

$file = $this->document_root . '/' . _SAPE_USER . '/sape.php'; //<< Not working in multihosting.
if (file_exists($file)) require_once($file);
else return 0;

$o['charset'] = get_option('blog_charset')?get_option('blog_charset'):'UTF-8';
//$o['force_show_code'] = $this->force_show_code;
if (get_option('itex_s_global_debugenable'))
{
$o['force_show_code'] = 1;
}
$o['multi_site'] = true;
// if (get_option('itex_s_sape_masking'))
// {
// $this->itex_s_safe_url();
// $o['request_uri'] = $this->safeurl;
// }
if (get_option('itex_s_sape_enable'))
{
$this->sape = new SAPE_client($o);


$this->itex_init_sape_links();


///check it
if (is_object($GLOBALS['wp_rewrite'])) $url = url_to_postid($_SERVER['REQUEST_URI']);
else $url = 1;
if (($url) || !get_option('itex_sape_pages_enable'))
{
if (get_option('itex_s_sape_links_beforecontent') == '0')
{
//$this->beforecontent = '';
}
else
{
$this->beforecontent .= '<div>'.$this->itex_init_sape_get_links(intval(get_option('itex_s_sape_links_beforecontent'))).'</div>';
}

if (get_option('itex_s_sape_links_aftercontent') == '0')
{
//$this->aftercontent = '';
}
else
{
$this->aftercontent .= '<div>'.$css.$this->itex_init_sape_get_links(intval(get_option('itex_s_sape_links_aftercontent'))).'</div>';
}
}
$countsidebar = get_option('itex_s_sape_links_sidebar');
$check = get_option('itex_s_global_debugenable')?'<!---check sidebar '.$countsidebar.'-->':'';
if ($countsidebar == 'max')
{
//$this->sidebar = '<div>'.$this->sape->return_links().'</div>';
}
elseif ($countsidebar == '0')
{
//$this->sidebar = '';
}
else
{
$this->sidebar_links .= '<div>'.$this->itex_init_sape_get_links(intval($countsidebar)).'</div>';
}
$this->sidebar_links = $check.$this->sidebar_links;

$countfooter = get_option('itex_s_sape_links_footer');
$check = get_option('itex_s_global_debugenable')?'<!---check footer '.$countfooter.'-->':'';
$this->footer .= $check;
if ($countfooter == 'max')
{
//$this->footer = '<div>'.$this->sape->return_links().'</div>';
}
elseif ($countfooter == '0')
{
//$this->footer = '';
}
else
{
$this->footer .= '<div>'.$this->itex_init_sape_get_links($countfooter).'</div>';
}
$this->footer = $check.$this->footer;

if (($countsidebar == 'max') && ($countfooter == 'max')) $this->footer .= $this->itex_init_sape_get_links();
else
{
if ($countsidebar == 'max') $this->sidebar_links .= $this->itex_init_sape_get_links();
else $this->footer .= $this->itex_init_sape_get_links();
}

}

if (get_option('itex_s_sape_sapecontext_enable'))
{
$this->sapecontext = new SAPE_context($o);
add_filter('the_content', array(&$this, 'itex_s_replace'));
add_filter('the_excerpt', array(&$this, 'itex_s_replace'));
}
return 1;
}

/**
* get sape links
*
* @return bool
*/







Развернуть/Свернуть




function itex_init_sape_links()
{
$i = 1;

while ($i++)
{
$q = $this->sape->return_links(1);
if (empty($q) || !strlen($q))
{
break;
}
$q .= $this->sape->_links_delimiter;

if (strlen($q)) $this->links['a_only'][] = $q;

//!!!!!!!!!!check it, tk ne vozvrashaet pustuu stroku
if ($i > 30) break;
}
$this->itex_debug('sape links:'.var_export($this->links, true));
return 1;
}

/**
* get links
*
* @param int $c count
* @param int $c a only if 1
* @return string $ret
*/
function itex_init_sape_get_links($c = 30, $q=1) //$q = a only
{
$ret = '';
for ($i=1;$i<=$c;$i++)
{
if ($q)
{
if (count($this->links['a_only']))
foreach ($this->links['a_only'] as $k=>$v)
{
$ret .= $v;
//$ret .= $this;

unset($this->links['a_only'][$k]);
break;
}
}
else
{
if (count($this->links['a_text']))
foreach ($this->links['a_text'] as $k=>$v)
{
$ret .= $v;
unset($this->links['a_text'][$k]);
break;
}
}
}
return $ret;
}



/**
* Footer output
*
*/
function itex_s_footer()
{
echo $this->footer;
if (get_option('itex_s_global_debugenable'))
{
//echo 'is_user_logged_in'.intval(is_user_logged_in()).'_'.intval(get_option('itex_s_global_debugenable_forall'));//die();

if ((intval(is_user_logged_in())) || intval(get_option('itex_s_global_debugenable_forall')))
{
echo '<!--- iSapeDebugLogStart'.$this->debuglog.' iSapeDebugLogEnd --->';
echo '<!--- iSapeDebugErrorsStart'.$this->error.' iSapeDebugErrorsEnd --->';
}
}
}

/**
* Content links and before-after content links
*
* @param string $content input text
* @return string $content outpu text
*/
function itex_s_replace($content)
{
//sape context
if (get_option('itex_s_sape_sapecontext_enable'))
{
if (url_to_postid($_SERVER['REQUEST_URI']) || !get_option('itex_sape_pages_enable'))
{
//if (defined('_SAPE_USER') || is_object($this->sapecontext))
if (is_object($this->sapecontext))
{
$content = $this->sapecontext->replace_in_text_segment($content);
if (get_option('itex_s_global_debugenable'))
{
$content = '<!---checkcontext_start-->'.$content.'<!---checkcontext_stop-->';
}
$this->itex_debug('sapecontext worked');
}
else $this->itex_debug('$this->sapecontext not object');
}
else $this->itex_debug('url_to_postid='.url_to_postid($_SERVER['REQUEST_URI']).' itex_sape_pages_enable='.get_option('itex_sape_pages_enable'));
}
else $this->itex_debug('sapecontext disabled');


if ((strlen($this->beforecontent)) || (strlen($this->aftercontent)))
{
if (get_option('itex_s_global_debugenable'))
{

$content = '<!---check_beforecontent-->'.$this->beforecontent.$content.'<!---check_aftercontent-->'.$this->aftercontent;
}
else $content = $this->beforecontent.$content.$this->aftercontent;
$this->beforecontent=$this->aftercontent='';
$this->itex_debug('links in content worked');
}
else $this->itex_debug('beforecontent and aftercontent is empty');
return $content;
}

/**
*
*
* @param string $domnod $text
* @return string $text
*/
function itex_s_widget_init()
{
if (function_exists('register_sidebar_widget')) register_sidebar_widget('iSape Links', array(&$this, 'itex_s_widget_links'));
if (function_exists('register_widget_control')) register_widget_control('iSape Links', array(&$this, 'itex_s_widget_links_control'), 300, 200 );

}


/**
* Links widget
*
* @param array $args arguments for widget
*/
function itex_s_widget_links($args)
{
extract($args, EXTR_SKIP);
$title = get_option("itex_s_widget_links_title");
//$title = empty($title) ? urlencode('<a href="http://itex.name" title="iSape">iSape</a>') :$title;
$itex = array('<a href="http://itex.name/isape" title="iSape">iSape</a>','<a href="http://itex.name/" title="itex">itex</a>');
if (empty($title))
{
$title = $itex[rand(0,count($itex)-1)];
update_option("itex_s_widget_links_title", $title);
}

if (strlen($this->sidebar_links) >23) echo $before_widget.$before_title . $title . $after_title.
'<ul><li>'.$this->sidebar_links.'</li></ul>'.$after_widget;
}

/**
* Links widget control
*
* @param string $domnod $text
*/
function itex_s_widget_links_control()
{
$title = get_option("itex_s_widget_links_title");
$itex = array('<a href="http://itex.name/isape" title="iSape">iSape</a>','<a href="http://itex.name/" title="itex">itex</a>');
$title = empty($title) ? $itex[rand(0,count($itex)-1)] :$title;
if ($_POST['itex_s_widget_links_Submit'])
{
//$title = htmlspecialchars($_POST['itex_s_widget_title']);
$title = stripslashes($_POST['itex_s_widget_links_title']);
update_option("itex_s_widget_links_title", $title);
}
echo '
<p>
<label for="itex_s_widget_links">'.__('Widget Title: ', 'iSape').'</label>
<textarea name="itex_s_widget_links_title" id="itex_s_widget_links" rows="1" cols="20">'.$title.'</textarea>
<input type="hidden" id="" name="itex_s_widget_links_Submit" value="1" />
</p>';
//print_r($this->debuglog);//die();
}

/**
* Add admin menu to options
*
* @param string $domnod $text
* @return string $text
*/
function itex_s_menu()
{
if (is_admin()) add_options_page('iSape', 'iSape', 10, basename(__FILE__), array(&$this, 'itex_s_admin'));
}

/**
* Admin menu
*
*/
function itex_s_admin()
{
if (!is_admin()) return 0;
$this->lang_ru();
$this->itex_s_admin_css();
// Output the options page
?>
<div class="wrap">

<form method="post">
<?php
if (strlen($this->error))
{
echo '
<div style="margin:10px auto; border:3px #f00 solid; background-color:#fdd; color:#000; padding:10px; text-align:center;">
'.$this->error.'
</div>
';
}
?>

<h2><?php echo __('iSape Options', 'iSape');?></h2>
<?php if ( '09_May' == date('d_F')) $this->itex_m_admin_9_may(); ?>

<!-- Main -->

<?php
?>

<p class="submit">
<input type='submit' name='info_update' value='<?php echo __('Save Changes', 'iSape'); ?>' />
</p>

<div id="itex_sape"><?php $this->itex_s_admin_sape(); ?></div>

</div>

<p class="submit">
<input type='submit' name='info_update' value='<?php echo __('Save Changes', 'iSape'); ?>' />
</p>

<p align="center">
<?php echo __("Powered by ",'iSape')."<a href='http://itex.name/isape' title='iTex iSape'>iTex iSape</a> ".__("Version:",'iSape').$this->version; ?>
</p>
</form>

</div>
<?php
}

/**
* Css fo admin menu
*
*/
function itex_s_admin_css()
{
?>
<style type='text/css'>
#edit_tabs li {
list-style-type: none;
float: left;
margin: 2px 5px 0 0;
padding-left: 15px;
text-align: center;
}

#edit_tabs li a {
display: block;
font-size: 85%;
font-family: "Lucida Grande", "Verdana";
font-weight: bold;
float: left;
color: #999;
border-bottom: none;
padding: 2px 15px 2px 0;
width: auto !important;
width: 50px;
min-width: 50px;
text-shadow: white 0 1px 0;
}

#edit_sections .section {
background: url('images/bg_tab_section.gif') no-repeat top left;
padding-left: 10px;
padding-top: 15px;
height: auto !important;
height: 200px;
min-height: 200px;
display: none;
}

#edit_sections .section ul {
padding-left: 10px;
width: 500px;
}

#edit_sections .current {
display: block;
}

#edit_sections .section .section_warn {
background: #FFFFE0;
border: 1px solid #EBEBA9;
padding: 8px;
float: right;
width: 300px;
font-size: 11px;
}
</style>
<?php
}

/**
* Sape section admin menu
*
*/
function itex_s_admin_sape()
{
if (isset($_POST['info_update']))
{
//phpinfo();die();
if (isset($_POST['sape_sapeuser']))
{
update_option('itex_s_sape_sapeuser', trim($_POST['sape_sapeuser']));
}
if (isset($_POST['sape_enable']))
{
update_option('itex_s_sape_enable', intval($_POST['sape_enable']));
}

if (isset($_POST['sape_links_beforecontent']))
{
update_option('itex_s_sape_links_beforecontent', $_POST['sape_links_beforecontent']);
}

if (isset($_POST['sape_links_aftercontent']))
{
update_option('itex_s_sape_links_aftercontent', $_POST['sape_links_aftercontent']);
}

if (isset($_POST['sape_links_sidebar']))
{
update_option('itex_s_sape_links_sidebar', $_POST['sape_links_sidebar']);
}

if (isset($_POST['sape_links_footer']))
{
update_option('itex_s_sape_links_footer', $_POST['sape_links_footer']);
}



if (isset($_POST['sape_sapecontext_enable']) )
{
update_option('itex_s_sape_sapecontext_enable', intval($_POST['sape_sapecontext_enable']));
}

if (isset($_POST['sape_sapecontext_pages_enable']) )
{
update_option('itex_s_sape_sapecontext_pages_enable', intval($_POST['sape_sapecontext_pages_enable']));
}

if (isset($_POST['sape_pages_enable']) )
{
update_option('itex_s_sape_pages_enable', intval($_POST['sape_pages_enable']));
}
if (isset($_POST['global_debugenable']))
{
update_option('itex_s_global_debugenable', intval($_POST['global_debugenable']));
}

if (isset($_POST['global_debugenable_forall']))
{
update_option('itex_s_global_debugenable_forall', intval($_POST['global_debugenable_forall']));
}

if (isset($_POST['global_masking']))
{
update_option('itex_s_global_masking', intval($_POST['global_masking']));
}

if (isset($_POST['global_widget_links']))
{
$s_w = wp_get_sidebars_widgets();
$ex = 0;
if (count($s_w['sidebar-1'])) foreach ($s_w['sidebar-1'] as $k => $v)
{
if ($v == 'isape-links')
{
$ex = 1;
if (!$_POST['global_widget_links']) unset($s_w['sidebar-1'][$k]);
}
}
if (!$ex && $_POST['global_widget_links']) $s_w['sidebar-1'][] = 'isape-links';
wp_set_sidebars_widgets( $s_w );
}

echo "<div class='updated fade'><p><strong>Settings saved.</strong></p></div>";
}
if (isset($_POST['sape_sapedir_create']))
{
if (get_option('itex_s_sape_sapeuser')) $this->itex_s_sape_install_file();
}
if (get_option('itex_s_sape_sapeuser'))
{
$file = $this->document_root . '/' . _SAPE_USER . '/sape.php'; //<< Not working in multihosting.
if (file_exists($file)) {}
else
{
$file = str_replace($_SERVER["SCRIPT_NAME"],'',$_SERVER["SCRIPT_FILENAME"]).'/'.get_option('itex_s_sape_sapeuser').'/sape.php';
if (file_exists($file)) {}
else {?>
<div style="margin:10px auto; border:3px #f00 solid; background-color:#fdd; color:#000; padding:10px; text-align:center;">
Sape dir not exist!
</div>
<div style="margin:10px auto; border:3px #f00 solid; padding:10px; text-align:center;">
Create new sapedir and sape.php? (<?php echo $file;?>)
<p class="submit">
<input type='submit' name='sape_sapedir_create' value='<?php echo __('Create', 'iSape'); ?>' />
</p>
<?php
if (!get_option('itex_s_sape_sapeuser')) echo __('Enter your SAPE UID in this box!', 'iSape');
?>
</div>

<?php }
}
}
?>
<table class="form-table" cellspacing="2" cellpadding="5" width="100%">
<tr>
<th valign="top" style="padding-top: 10px;">
<label for=""><?php echo __('Your SAPE UID:', 'iSape');?></label>
</th>
<td>
<?php
echo "<input type='text' size='50' ";
echo "name='sape_sapeuser'";
echo "id='sapeuser' ";
echo "value='".get_option('itex_s_sape_sapeuser')."' />\n";
?>
<p style="margin: 5px 10px;"><?php echo __('Enter your SAPE UID in this box.', 'iSape');?></p>
</td>
</tr>
<tr>
<th width="30%" valign="top" style="padding-top: 10px;">
<label for=""><?php echo __('Sape links:', 'iSape');?></label>
</th>
<td>
<?php
echo "<select name='sape_enable' id='sape_enable'>\n";
echo "<option value='1'";

if(get_option('itex_s_sape_enable')) echo " selected='selected'";
echo ">".__("Enabled", 'iSape')."</option>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_enable')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";
echo "</select>\n";

echo '<label for="">'.__("Working", 'iSape').'</label>';
echo "<br/>\n";

echo "<select name='sape_links_beforecontent' id='sape_links_beforecontent'>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_links_beforecontent')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";

echo "<option value='1'";
if(get_option('itex_s_sape_links_beforecontent') == 1) echo " selected='selected'";
echo ">1</option>\n";

echo "<option value='2'";
if(get_option('itex_s_sape_links_beforecontent') == 2) echo " selected='selected'";
echo ">2</option>\n";

echo "<option value='3'";
if(get_option('itex_s_sape_links_beforecontent') == 3) echo " selected='selected'";
echo ">3</option>\n";

echo "<option value='4'";
if(get_option('itex_s_sape_links_beforecontent') == 4) echo " selected='selected'";
echo ">4</option>\n";

echo "<option value='5'";
if(get_option('itex_s_sape_links_beforecontent') == 5) echo " selected='selected'";
echo ">5</option>\n";

echo "</select>\n";

echo '<label for="">'.__('Before content links', 'iSape').'</label>';

echo "<br/>\n";



echo "<select name='sape_links_aftercontent' id='sape_links_aftercontent'>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_links_aftercontent')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";

echo "<option value='1'";
if(get_option('itex_s_sape_links_aftercontent') == 1) echo " selected='selected'";
echo ">1</option>\n";

echo "<option value='2'";
if(get_option('itex_s_sape_links_aftercontent') == 2) echo " selected='selected'";
echo ">2</option>\n";

echo "<option value='3'";
if(get_option('itex_s_sape_links_aftercontent') == 3) echo " selected='selected'";
echo ">3</option>\n";

echo "<option value='4'";
if(get_option('itex_s_sape_links_aftercontent') == 4) echo " selected='selected'";
echo ">4</option>\n";

echo "<option value='5'";
if(get_option('itex_s_sape_links_aftercontent') == 5) echo " selected='selected'";
echo ">5</option>\n";

echo "</select>\n";

echo '<label for="">'.__('After content links', 'iSape').'</label>';

echo "<br/>\n";

echo "<select name='sape_links_sidebar' id='sape_links_sidebar'>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_links_sidebar')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";

echo "<option value='1'";
if(get_option('itex_s_sape_links_sidebar') == 1) echo " selected='selected'";
echo ">1</option>\n";

echo "<option value='2'";
if(get_option('itex_s_sape_links_sidebar') == 2) echo " selected='selected'";
echo ">2</option>\n";

echo "<option value='3'";
if(get_option('itex_s_sape_links_sidebar') == 3) echo " selected='selected'";
echo ">3</option>\n";

echo "<option value='4'";
if(get_option('itex_s_sape_links_sidebar') == 4) echo " selected='selected'";
echo ">4</option>\n";

echo "<option value='5'";
if(get_option('itex_s_sape_links_sidebar') == 5) echo " selected='selected'";
echo ">5</option>\n";

echo "<option value='max'";
if(get_option('itex_s_sape_links_sidebar') == 'max') echo " selected='selected'";
echo ">".__('Max', 'iSape')."</option>\n";

echo "</select>\n";

echo '<label for="">'.__('Sidebar links', 'iSape').'</label>';

echo "<br/>\n";


echo "<select name='sape_links_footer' id='sape_links_footer'>\n";
echo "<option value='0'";
if(!get_option('itex_s_sape_links_footer')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";

echo "<option value='1'";
if(get_option('itex_s_sape_links_footer') == 1) echo " selected='selected'";
echo ">1</option>\n";

echo "<option value='2'";
if(get_option('itex_s_sape_links_footer') == 2) echo " selected='selected'";
echo ">2</option>\n";

echo "<option value='3'";
if(get_option('itex_s_sape_links_footer') == 3) echo " selected='selected'";
echo ">3</option>\n";

echo "<option value='4'";
if(get_option('itex_s_sape_links_footer') == 4) echo " selected='selected'";
echo ">4</option>\n";

echo "<option value='5'";
if(get_option('itex_s_sape_links_footer') == 5) echo " selected='selected'";
echo ">5</option>\n";

echo "<option value='max'";
if(get_option('itex_s_sape_links_footer') == 'max') echo " selected='selected'";
echo ">".__('Max', 'iSape')."</option>\n";

echo "</select>\n";

echo '<label for="">'.__('Footer links', 'iSape').'</label>';

echo "<br/>\n";
echo "<select name='sape_pages_enable' id='sape_enable'>\n";
echo "<option value='1'";

if(get_option('itex_s_sape_pages_enable')) echo " selected='selected'";
echo ">".__("Enabled", 'iSape')."</option>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_pages_enable')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";
echo "</select>\n";

echo '<label for="">'.__('Show content links only on Pages and Posts.', 'iSape').'</label>';

echo "<br/>\n";
?>
</td>


</tr>
<?php
?>
<tr>
<th width="30%" valign="top" style="padding-top: 10px;">
<label for=""><?php echo __('Sape context:', 'iSape'); ?></label>
</th>
<td>
<?php
echo "<select name='sape_sapecontext_enable' id='sape_enable'>\n";
echo "<option value='1'";

if(get_option('itex_s_sape_sapecontext_enable')) echo " selected='selected'";
echo ">".__("Enabled", 'iSape')."</option>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_sapecontext_enable')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";
echo "</select>\n";

echo '<label for="">'.__('Context', 'iSape').'</label>';

echo "<br/>\n";

echo "<select name='sape_sapecontext_pages_enable' id='sape_enable'>\n";
echo "<option value='1'";

if(get_option('itex_s_sape_sapecontext_pages_enable')) echo " selected='selected'";
echo ">".__("Enabled", 'iSape')."</option>\n";

echo "<option value='0'";
if(!get_option('itex_s_sape_sapecontext_pages_enable')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";
echo "</select>\n";

echo '<label for="">'.__('Show context only on Pages and Posts.', 'iSape').'</label>';

echo "<br/>\n";
?>
</td>
</tr>
<tr>
<th width="30%" valign="top" style="padding-top: 10px;">
<label for=""><?php echo __('Masking of links', 'iSape'); ?>:</label>
</th>
<td>
<?php
echo "<select name='global_masking' id='global_masking'>\n";
echo "<option value='1'";

if(get_option('itex_s_global_masking')) echo " selected='selected'";
echo __(">Enabled</option>\n", 'iSape');

echo "<option value='0'";
if(!get_option('itex_s_global_masking')) echo" selected='selected'";
echo __(">Disabled</option>\n", 'iSape');
echo "</select>\n";

echo '<label for="">'.__('Masking of links', 'iSape').'.</label>';

?>
</td>
</tr>
<tr>
<th width="30%" valign="top" style="padding-top: 10px;">
<label for=""><?php echo __('Global debug:', 'iSape'); ?></label>
</th>
<td>
<?php
echo "<select name='global_debugenable' id='global_debugenable'>\n";
echo "<option value='1'";

if(get_option('itex_s_global_debugenable')) echo " selected='selected'";
echo ">".__("Enabled", 'iSape')."</option>\n";

echo "<option value='0'";
if(!get_option('itex_s_global_debugenable')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";
echo "</select>\n";

echo '<label for="">'.__('Debug log in footer. For see debug user must register', 'iSape').'.</label>';

echo "<br/>";

echo "<select name='global_debugenable_forall' id='global_debugenable_forall'>\n";
echo "<option value='1'";

if(get_option('itex_s_global_debugenable_forall')) echo " selected='selected'";
echo ">".__("Enabled", 'iSape')."</option>\n";

echo "<option value='0'";
if(!get_option('itex_s_global_debugenable_forall')) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";
echo "</select>\n";

echo '<label for="">'.__('Debug log in footer for all, who open the site. Dont leave this parameter switched Enabled for a long time, because in this case it will disclose your private data like SAPE UID', 'iSape').'.</label>';

?>
</td>
</tr>
<tr>
<th width="30%" valign="top" style="padding-top: 10px;">
<label for=""><?php echo __('Widgets settings:', 'iSape'); ?></label>
</th>
<td>
<?php
$ws = wp_get_sidebars_widgets();


echo "<select name='global_widget_links' id='global_widget_links'>\n";
echo "<option value='0'";
if (count($ws['sidebar-1'])) if(!in_array('isape-links',$ws['sidebar-1'])) echo" selected='selected'";
echo ">".__("Disabled", 'iSape')."</option>\n";

echo "<option value='1'";
if (count($ws['sidebar-1'])) if (in_array('isape-links',$ws['sidebar-1'])) echo " selected='selected'";
echo ">".__('Active','iSape')."</option>\n";

echo "</select>\n";

echo '<label for="">'.__('Widget Links Active', 'iSape').'</label>';

echo "<br/>\n";

?>
</td>
</tr>


<tr>
<th width="30%" valign="top" style="padding-top: 10px;">
<label for=""></label>
</th>
<td align="center">
<br/><br/>
<a target="_blank" href="http://itex.name/go.php?http://www.sape.ru/r.a5a429f57e.php"><img src="http://img.sape.ru/bn/sape_001.gif" alt="www.sape.ru!" border="0" /></a>
</td>
</tr>
</table>
<?php
}

/**
* Sape file installation
*
* @return bool
*/
function itex_s_sape_install_file()
{
//file sape.php from sape.ru v1.0.4 21.07.2008
$sape_php_content = 'eNrNPGtz20aSn6VfMdKqDCKhSMnJOlm9bJ+jxK712j5Jvro72culSEjimSIZEoztjfW/7nOqri6Vq8SXuqvarxBNWDQf4CuO4pJjbffMABgAAxCK49SyKjEFzPT0a/o1PVy5XNmvTKffmybvkc2rd9ZT1TqZnydf90Zmp2O2R2Oj87pnnJFhazgyuwZpj/ud1nx/YDWN5y0yHJ52rDbMxel3rt+Zb3daZm+UJA1zMGydkcXUQupDYo3IRfj2UeriwsLHfPBTizSGZpc0LIA1
NLrEOhoYr4wXI3P4mvQMUqtXKuWqfqWWrWiAE5/1lXnUNQCRwekM+dYkvfHznkV6rRPzmUW6Zu9s9Jo0yM8jq0t+MF50zBny1RBGwYyB9aLdIvPkxByYx6R
vDIyuORqckv6gRRqnx1bDJG0gKYWL/K01QjyWyL6uV5bS6YcPH6Y4Gund7OcpZBhFJz09nU5/N+xZjZ71grQ7xnAIlJ/2rU7v7M2r1gug8A0ZjEet3ng6V8zWapTDmZ1sTSNfTk8T+HyRrZK5zBdatVYol4j7WSUK8u4DZdk3bqc
Mk8Vxu9liTfOMyu1nqzVN90JTlon3k06L9AFNqZKmpw+ypXq2mNZK6d16KacDUqlCrlz6ghItrFHTqoB
M
plio6c4a2Wo1+zih5Au1ilaCAfMLizbflCQRn190nqtezLO5fQ2A7mp64UBjUD+4tLCw7Mf8qfXc6Jgg
J
BDuT2RoDkDfyJKlMmAw4L+GHdDOtnFigEocGcdjrqqkZ5Jx0+hYw9dJMrLIsGM2x29egYL3rf7pqG2Qo
3
HTHHE9GY6szus2jDLb414zgGhVK5azeYbqKkE8RWK0arVc9SBOxSAO2S/XdBI9pKp9XtdqeqZeLYQNOagX9UKmVtC1KK0Anub2AdxBWdcy+uOKJtMK4Nz3fWtoHQE7mu3OmxOzB7u
4TVn2n72e1R1zZo/J9m6hqGX2ND0D+qFrJb32JFevFp/UyrkHmn7foyz0UQYZVa7rDMFLEn38vs3Y/byJUrNGDXNkeEgoV3NaprZffghr5rUQQgu1TLlezeyUdTI1ZQ/wLESVAxVnYB1ZI3FuXtup7/kEYq8wxYfsZJBy+hLhAw+n4JNOPx0D0m1qeIBLpGn0eqfdFoNubybXACTmyhV8UoMVSvViUbUtgqPh5k
sD0Fwqq+7zOaowggLgp7BLEkAz2302VBXhiXSwUWAWnCHbCkJT7geGiiv5By97Rh46fx0SDbiEi9T0al
E
rhSPih+yFKHCFEaQu+9bwg4ua4OHoN0YbrPQQTPtlD+9shBGvILb6fqE2v5axkcZ/J2Hkm5LZXN/4l/WNbeX61tadzPXbm1siGwUcfRMrVW0P9mulmM1pCSX9Z2qt76XvpdNoTeE/cbxA9QQwYO3vpUJA+NiFbn80MHqtH43L01GKJBgp0Cdy4QLxaYF/SBibRWsnKp9ndkz++2A5YthY/+e765tbmbsbN0IEAdR/a4BrGJ8YL5LERGvx0joxR8Mz0u1ZEGqgElkNCDWsJnr+vtFvm5EMck0054/8FVldJXq1roWxR7D0bGAY+t9b1tErakSPiPVT66htvIzEjwcWAeSc55MwsyOTaLS+sZqtgdVoG5HI8Pg
lTJPc12HI2AGQqEHOLCluMjQCDjMMIdnAMNRkXjgSUmx0vU6W4wp+oVQ/0KqF3KSR4a/JGlkII8fn2VcjwITpBEToz5oGhM0NUA7Q2BOzPQ+heLRovIFAgITA+0nq648sotX4KxvXVu8Ha9A1fmy
9IRZpmkfGs2gzQMOLALb86SQcWWwSgRmuOJPXdgslLZ9QMjTUuAtWTwloY1XT69WSDbmaLdQ0Fq4mFMi
q
jg2IXSDTs3rDkdEbGUQEFcaT7/oDs2l2ziClw8gKTCYLriTsyFy7ffuPN9ZBRSAJAH6XHxRsEYa9RN64WITuLiH08/MpEgdRLiHvEINFVZVESpHikUVJcZDnQaeU108hN+maP7UaBjB72G8NMQPnn1o1W8onEruQmOjqQSFXLe
MGTKiQ1i4u0I8jQRAaqe3Xd3eLEIza+9lN6/g4WJnlVO+xae+R/x/32j9CVtDsnE3MEvictDcI9pg5DKZZ8AXhSCWr73si4bk6oJTJ7kF+gdaFo+k+TClESQlOCNNoIY65Uii
BvwSBK9liETY3JCiw1yENhdjH+SwKSu1OgI2UBXfrM3F0ntz6SaG4mIor+kkTpqKOxvUckAgEkjDFM/nJE8+fiVDtlUNXAuMvXAg8ssWa0R6B2tQSEpzUOHCQZ3syUal073nGuwBRWyD9ivKvEoSCdmEun9WzMP
hKYHBC4XUShaR49pLimirLnGzbivD8dkCSLp1D1phe/wOIF9HIgLB0n1jPJxNKjEQMuX0UgrNGQvWYA2eD0QGww8CJ4pwkuXZ34+btOxjV3/RttHDxLZ8D7vX1q5+sb4igqYk+F4yN9a27G7e2Nq7e2vyUwaL+/jwgrt2+dWv92tbWjT+t3767FcsYxeAZ+NSrn63f2krKbVNwq4obhoLVHmk5BCrdEtHbwrc1vOjmimWsl
eT8wgrspRgqxzjkU7q5HfCAvKTieb5bodYAJ6EVsl3UxwvgpiBWKpXZv5ANJOPJgDJttyJj0JXdSh22F
r
xNktnP1rfIl1RBDwmWDNKLqYV71Xul67D+ErxBPA7xwaxMyCKku1hsvYpCxHmuSOnsMAgP97G6lZi5sq
u
VdynCYSJlrEshl8Be8kUXL36syuQbRJSLFhaQaBjQv4dC0x5VihCQJ2YdlJNsXdkkW8dw7vbi/XCNcb9GR8Jd69nYjnEg3h9ikMMjmyUSsCcpcPGoa0tCSBJQRDeskkdVJyMaTLWOScdq49kL1huwpmjIY
ymAnc0DF0FopeyB5g2euA4z/bWHJIlS3RED+SsQLeYeMPHdvH3tj5nN676ARKK2uaIGCbWe1WkpPOGT+Rwstafv2/60VvirJuDoG3vweRUGoss9yO4VcpnP68CsWqZaL7HY1Tu8FjZuQbbfGB7SCqfj8DkHgXp7uE9zZFG7CM
JvOw7jIYyE+5YKiOLurcCI0H0jN7HnU/Yh6DnWjWj12kQ1pLrHtd0nwVAlPjYgK2mRhq3Dpy8omBANflgt6Jqon5SCeJr80KPJIboa4Or6v4bqq1
3doSj4WW9jWuE4hmnMW4kRiTjI/z7h1jE9G1wlM6uEvqcoRoWgMjkbg/FPJmT3P5odazjqwX9c2C/pWagjOZSXXOohPpsvGlqdiKF8dHFB+6KwCNU9PEc+skbtFi182qmxX+nE9ed8VpPznZ3fwe5eqYBWPC5
qq7O5crFcXQJS8stkF9KD+YdaYW8fvOtOuZhfnl3DCgVZ39i4vcGR1uB/ykq6suY/sAnUTeW1n0q1AImvB6Mo5gpVg0PfwROeVGZQYxLiGk7xgh9quSk2mmP+NKH6kJ8p1Hja7p0eUEY8xzod
GWYXPOfQOqbHeijSVEDhr+jlem5/IkAWGO4flPP+oUmycOnSJXXZXnZgNAzSBPUe94141jxSQUfMDjKp+pgGIk6R7zl57vlyinx1OhwZjdbI
hK2F6Hz00UfY2oDHBeOUooZWiYLcRsOT3YnB8QlEcIYgFnSzOQeWS2GUzcSnQsD7SjA88NCE0A+YE/QRRFZIgrn9eaec7+kKUCHrJW5Q4Z8OG2khkDKCQvxtZB2donT6VsMcYvG237FeGc32mLCeFYO0IPjig4
5OOxY93GlgqY1aR+DXwBpaDa8Zl6pt0iaBzBM5EeR93wu3lUD1+wMaW/p3pt1LkcGXCUnkY/sx75GI/KyXLgBxvHKBD1sVlYE/izT+u2XwUpC6ywqJJFsjcwWyukbm2FMVUrWwbJLPl1QI2dykUHmZkqWltfoOkJ7g7nkBExKqFMqnV7eu
3uTGWZFOFwyixz3wUCAw3k08ZZBA57b7Q7PRtO6D4kDK0BadbmtJPovawjpKtpAtUgVnsdAMLwmHIi5a
c
x6m+JUylBD7swNCfBDy/lBCv/fR4WRzBjz5vyNWt75z/c7m+ubmjU9kZ/E1rYaF3Ewhn1CDxX7+FoM1Pg7jAthtYK6o5orTl2OcDcOqzgk5b2K6DCkcB5NULrh/qN5zcwGOGnom49NtHtBFGHK7jIGZA3XZEo3wLMf+D8sKXWa5YgGL5tojXSvlfZ1nvJWlWCg9qGXyWrFw
AApT5ZmM+FLsqvBM4um5/6WnWq/QNa8xPEDedgzkbYZheMraYSgrKtkq1i+Wgo0zwZYHIcYJCRKv5U47EBl2Lewb7ENycnzaQK/dt8iJMRyddUOiRepVGemJuRLHEdSgvLvLDpq9PsfbksMl7TIuWNOc08t6tkhfOozPlevIl+BsSb4wIx7
0lqiLBDTXgnCl9r9EldM3MtLezwW0w+8OQO1xay0uo+1fAfgl/Pb++zIE6CbhrFwjC/R0lE1iD8MKUHTxTG2/sBvCp1CLLbWedOr2fZuqcwGOZNa+flAEqP9RLpR84Jy9l+TL+2AHCxqBw0J59xZbUVmhR5glWDivPVpj
FSt8RbMS77uoEoY0xERAy9PRZ5vecFTgYcBY+vMVbwIigBW54PbDhMTB+UKV+oZM5tMbN9czGeoj0mJ0
w
wt4SorilsrvKMuxSJJDlgGJIM8XxXGTx1dQ0tiKgI23l9GsUs/mnoHjchcQ+VU/NfL8z/ElzH3wpTyCQSvgrR0JB+biwG0lk+Fn41x9M5mInpegm4kBzc9AJzhie/OB9tg+kJL44qR3BXquf0VukLcl0yeRwp3fZDgRqjQ1ibcljZ2BZnxtRxMHeyKJKbnRoA5C3vuiirOnYh
AuwWFZAOGKb+owuCmwvUAMWvDM9VF01PKwXM3LAhP6/DyBCV+LRSZCl3GhiDqoZ/fcVchsdjZJZnE8xCP0e00rajmdfstVCxX2DctE+KWY3dGK+KVU5m8J/YPaWny+U9f1cmmWqPKYiKEmC4qmfuWI6L+NLpYDhx3az9geD9smGZntIc2HsZbW7ZyZI4IXLEbmM6PbI
lTYlBAOw4mZ/EETjahhaAaJgZRw74BGeviXoGVzdueMWEYX1Za+93Xe8EmQtM6uzMzPg5j26gidhh4hKy8ReoCUQp5d+
jCjlVDdOTopesBE5ufXZsMsjzcec7VNtRvkfFkKbDXcVxp2EeQ0WX+ynFDpQYNNrUKptYHWRHKXiN+Hh
7
rwdJqWqyAN6xrDYatBWsOXVhOrHFT0oArY3HOMqnEanecLmw7T/BJP8xl6km6pdJoqHLaJNYYmGY5f0WwYC0rDVrdhdU6DxIOTzEHuwwoRDh+lMZxyIXtQWVYQC8jakiFj8
ByGD5oNtOWQkEm/W/jgD3zSPSUUdNEGvBI6ZM8eAvFYYIgktpwTVAicQKFCTVPC5XJwiismL+9QRLvV8gGVkl5W5YGwmA7T4e
hO8bg7YsVDiaSfDkw0IMdjW9h980dbymBrbNlHEoxBJqeBkhBJdjr9TcMatQawYCRQ2hJPD+NccEmMC2
X
ct40J1bqwXUzdLAV7kMXKVbZYTCjpxIXt32Xn/3p1/t8X5v9w/8uLyUuHy2q6ULurCMzELLKu+zsLp6Z4DrW6gHnTCjc+MHJ78b7KUyn/lKm5egmZhS7aI/htPnF7rnDfdyyOs0BZirR31xnkHxPkxDZfC9MlCsA/xasRU4ckcp9NCYZBNApf/8/XJMEfvH7ClMfbdjTlKrtXVKjsNj/WGI4hCu/bYa7y4xxQjERCSdHvKUV9gt8ZWPhLVTzbIkjWYSiV/YF1ZMJGwFK6OTCBwFPSwktrNvVsgK/gLHMtIN7SfR/qClGSgPe9GiB8obRTqyyr6vtKMmr3yNPySa7J656kqKXc5o3JmXOs7DeOowRXHukPfQ6R3vL4eWShMBq
nLzASstr0iiAeB4ybILGmdWQ0OnjHdMXXKlSoQsAPcZm87Tid7o8hnjqjcsbTBOOM+1c8a42mmO97P1t
Z
zCFpjJvjXYuSrgR+W0oreUNb0Np0+rtRe3A6OsXe7yOjZ+Lh6+jnZxLTTE+tEQC/PZhOf2scN4xei0aN41cYJx4bAKxhvKF/ABhjWmKp/9c45pXgvsWdwhj2wonRMWigKTuloPwFLdfLDxKs7xdCtyT6Wlk3EG9kYvNmVu0CulyFgQViA7tN0s8SR
GzRuOYeTf3lWkH9c+Je+vI2WHw09++reMmKrg7/0HEgt5DlI1AwQ1BgUX52jxa/bb4Uyw+1asJejbqKeOs5Mmu9wN59IDx0nnjKYq+fXEgusmMWcKLhJAZUKADH04wdtnosoxQePTsI0EYt
56+UQoI2Y3KcE6u2GLZ/3jWp9nZnLWmcyW9LaLg65kq6bVzsgMW2N5GKSC/kiioIWk+GVqNvQJIyIkP82+pizAhGxiQWs1bsTNZ8xc5ncUgjUmkTLn4sZaO3PRwMt53X84v0uocrLHW
CTrOaVKVciUfwLxRuULw+oZK8VtR0LU9ojO+a+reRttuY7TAHeLOgTkb2F1EozXZ1tOA8sqFJ/mSCJhMVpeCTVLUHSukoYb9jvWxx/aMBA+1AMkan6N0iFTKwR1j3QjSXeKjSMwXtf4EGmwUrxkmrh17VboMaT5TsTKHkFEYdM+wUB91imBpD5
pB2FAssFKoJ3buQ6jqu8KI6WXLsjhPePX5pNSgfh2ex9M0Ol1wsKE8vqvE0D6MZzj+M1Y6sAfkBEtiwa
k
jYR0i/fXFbvCJJFIWeqIOeSzMwKYWGGwLl6P3ZrbX4K/hluI2W0H+FPLCqJ/GYg8Tj3pxwRu6WiDAZUANITvb5v5plmWBLXarAwswLXdxeEuA1pzYf0xLFt0qxilETHSloKqSS1CBgMx
pNqkcD66Q9xo5evDLYNs6j0PYH2xAk2QiV6/IvgSRXkeV3wqF4jI83yk5GPKq8AJqxhmrkUe94fLE5Kxiut3ZwcQJSQW0w/Ro6TkXwKX2ra75Cm4j5HIvBHO832SO48RUtFdkuZvm3ix/8UVI2n4edq5fdCAlNWLnym4YYv0hiQvjBE8QzmiCynzLC1n2zm8QuRuq+mjCo22Il/enfxFfFcFCo27Hdkr3NJjmgc3sgFoosysoG71IN35mDmWy1pt+F80jGgMp6amlDLWu7apodbLnq9qznE
OI1WPxKf4Nt+t36n7fzOb/uTp+enmiJB+bzVpf9qkSrx/c4+5WM7vRbK6pTJ8SiLR0dzj/pAe1kGjkxdk3VOKMtdq/tmionxVdL9RAj1FXVmKTg4AhKPJVa328snMsSB/mXUlZgP4evH8akpxb+zhBuMvZTdGPGpukIDaY2VL6Kv0q6osQ6rKOVVJhW1KuFg4RNnGQqx0A+gHd1+H
kX/yyfGcpbZYKb8y/sdJueLXutoKelKgq6H/L6rU+WEPYDUt4N7U9QhdUka8RqohFfBZDivObNebz9jhWzU3ZbXqApL9guRA1Y3Hah8MHSnzRBDFOrZO
LsXyCTya0U/tYrjoytHE4pKI9VzdnguVK8JoUvssW6JKBxaacDws6uPFvIRVGmpx7n4YIXjK5vPzpNkzB0cteOvwknr
AcHyU9coHentWqgW3lic4vXaA2c0xsMDdp4STrQF+RvBsA7EBhMmHjlEM8YzGetyEk8G3JPtGgYSB+yE
5
eDgppYuZe+LOwYdujCiEySeWllgZYy7RKVp2IUbvfcGiibuBYev3K/R8l8aeFvsDXpdamBIVDrLdbRUl1Ipc6/8Cr5ICpydlqveee1QC19sIr/e39yRczLEewJcBv/Qju7AnOiorKQmOkw/LcGaO9o4YDXFN1yV4TY4vgf6UKOwdnEJcjOY7LpCI84LF3FAyT7j5QSEaxLyIoOMpxcD39Pq9Py6w52B
4yp6sBOZDcY/un2J/82HUOYETtpp5x/vP3ntfvvBTZSktzZWP8ss3nn5o2tzCfrN2/8KXPt6p2tuxvrYWx3f2cVuxqspjmAeNYySdd83hwTXGk6Xh3XFi9mjb+PlJ1X/xbuuxUa91nK9ySyQhMYe+5NcDFyDwQGBzH+IIDxh1EYewpJLgz1vFM+jMbb2Y4x+JsKUBkB+VybNXrD4
n6YlD+HGaHYlZjA7iT06bBrPcPfwHN3Z7jC/zpkX8uW/qKT2q9B/HRUviplDT1HkkTIEIjOhIXI4rswkl0985WAwr2/4tqtuL/j8VvG1hL5nSPKjtM1FUOVAsozMeXyLnMY+FUHBnD5H+MqD2Xk217lkQERovXomzxEdpXHbut/iys9U6EXeui94CmPKrn3eaZsbp/v8gyFYv+OrPfuDNPV0LszU26+E0jB/AovvzgzxSieYvdapy+vTf8ddojikQ==';
$sape_php_content = gzuncompress(base64_decode($sape_php_content));
$file = str_replace($_SERVER["SCRIPT_NAME"],'',$_SERVER["SCRIPT_FILENAME"]).'/'.get_option('itex_s_sape_sapeuser').'/sape.php';

$dir = dirname($file);
if (!@mkdir($dir, 0777))
{
echo '

<div style="margin:10px auto; border:3px #f00 solid; background-color:#fdd; color:#000; padding:10px; text-align:center;">
'.__('Can`t create Sape dir!', 'iSape').'
</div>';
return 0;
}
chmod($dir, 0777); //byli gluki s mkdir($dir, 0777)
if (!file_put_contents($file,$sape_php_content))
{
echo '
<div style="margin:10px auto; border:3px #f00 solid; background-color:#fdd; color:#000; padding:10px; text-align:center;">
'.__('Can`t create sape.php!', 'iSape').'
</div>';
return 0;
}
//chmod($file, 0777);
file_put_contents($dir.'/.htaccess',"deny from all\r\n");
echo '
<div style="margin:10px auto; border:3px #55ff00 solid; background-color:#afa; padding:10px; text-align:center;">
'.__('Sapedir and sape.php created!', 'iSape').'
</div>';
//die();
return 1;
}

/**
* 9 may section admin menu
*
*/
function itex_m_admin_9_may()
{
if ( '09_May' == date('d_F'))
echo '<center><h1><a href="http://itex.name/plugins/s-dnem-pobedy.html">С Праздником Победы!</a></h1><p><object width="640" height="505"><param name="movie" value="http://www.youtube-nocookie.com/v/TQrINrPzgmw&hl=ru_RU&fs=1&rel=0"></param><param name="allowFullScreen" value="true"></param><param name="allowscriptaccess" value="always"></param><embed src="http://www.youtube-nocookie.com/v/TQrINrPzgmw&hl=ru_RU&fs=1&rel=0" type="application/x-shockwave-flash" allowscriptaccess="always" allowfullscreen="true" width="640" height="505"></embed></object></p></center>';

}
/**
* Url masking
*
* @return bool
*/
function itex_s_safe_url()
{
$vars=array('p','p2','pg','page_id', 'm', 'cat', 'tag', 'paged');

$url=explode("?",strtolower($_SERVER['REQUEST_URI']));
if(isset($url[1]))
{
$count = preg_match_all("/(.*)=(.*)\&/Uis",$url[1]."&",$get);
for($i=0; $i < $count; $i++)
if (in_array($get[1][$i],$vars) && !empty($get[2][$i]))
$ret[] = $get[1][$i]."=".$get[2][$i];
if (count($ret))
{
$ret = '?'.implode("&",$ret);
//print_r($ret);die();
}
else $ret = '';
}
else $ret = '';
$this->safeurl = $url[0].$ret;
return 1;
}


}

if (function_exists(add_action)) $itex_sape = & new itex_sape();

?>





Вставляю этот код в Notepad++ с помощью поиска нахоже 10 ссылок удаляю их а ссылка все никак не уходит.
Подскажите плиз как выйти из ситуации?


Сообщение отредактировал Baer - 28.11.2011, 17:03


--------------------
все ок
0
Вернуться в начало страницы
 
Ответить с цитированием данного сообщения
WebAction
WebAction
сообщение 25.11.2011, 20:33; Ответить: WebAction
Сообщение #2


Топовый постер
*******

Группа: Super Moderator
Сообщений: 3059
Регистрация: 18.11.2009
Поблагодарили: 2511 раз
Репутация:   249  


Для таких как Вы придуман код спойлера и кода.


--------------------


Поблагодарили: (3)
Вернуться в начало страницы
 
Ответить с цитированием данного сообщения
protasov7
protasov7
Topic Starter сообщение 25.11.2011, 20:51; Ответить: protasov7
Сообщение #3


Бывалый
****


Группа: Banned
Сообщений: 300
Регистрация: 17.8.2010
Из: Россия
Поблагодарили: 16 раз
Репутация:   -16  


(WebAction @ 25.11.2011, 22:33) *
Для таких как Вы придуман код спойлера и кода.

Можно конкретнее?


Сам разобрался спасибо.


--------------------
все ок
Вернуться в начало страницы
 
Ответить с цитированием данного сообщения
Akara
Akara
сообщение 28.11.2011, 1:47; Ответить: Akara
Сообщение #4


Новичок
*

Группа: User
Сообщений: 25
Регистрация: 23.11.2011
Поблагодарили: 5 раз
Репутация:   2  


А почему ручками не хотите код вставить? ИМХО нехорошо удалять ссылки на автора, если уж пользуешься результатами труда.
Вернуться в начало страницы
 
Ответить с цитированием данного сообщения
kronos
kronos
сообщение 28.11.2011, 1:54; Ответить: kronos
Сообщение #5


Белый веб-мастер
*******


Группа: Active User
Сообщений: 4703
Регистрация: 10.2.2009
Из: Харьков
Поблагодарили: 2629 раз
Репутация:   327  


Она вшита в код в этих каракулях $sape_php_content = 'eNrNPGtz20aSn6VfMdKqDCKhSMnJOlm9bJ+jxK712j5Jvro72culSEjimSIZEoztjfW/7nOqri6Vq8SXuqvarxBNWDQf4CuO4pJjbffMABgAAxCK49SyKjEFzPT0a/o1PVy5XNmvTKffmybvkc2rd9ZT1TqZnydf90Zmp2O2R2Oj87pnnJFhazgyuwZpj/ud1nx/YDWN5y0


--------------------
Вернуться в начало страницы
 
Ответить с цитированием данного сообщения
Baer
Baer
сообщение 28.11.2011, 17:06; Ответить: Baer
Сообщение #6


Злобный SEO Батька
****

Группа: User
Сообщений: 317
Регистрация: 30.6.2010
Поблагодарили: 846 раз
Репутация:   41  


(protasov7 @ 25.11.2011, 19:51) *
Можно конкретнее?


Сам разобрался спасибо.

В случае с такими длинными кодами необходимо разбивать код на несколько спойлеров или же прикреплять сам код в файле.
Вернуться в начало страницы
 
Ответить с цитированием данного сообщения
Открыть тему
Тема закрыта
1 чел. читают эту тему (гостей: 1, скрытых пользователей: 0)
Пользователей: 0


Свернуть

> Похожие темы

  Тема Ответов Автор Просмотров Последний ответ
Открытая тема (нет новых ответов) Как повлиять на быстрые ссылки в гугле?
5 maxg5 1361 Сегодня, 1:14
автор: Ley
Открытая тема (нет новых ответов) как правильно написать альт и тайтл для изображений
0 galaker 320 Вчера, 22:50
автор: galaker
Открытая тема (нет новых ответов) Как установить источник заражения сайтов?
7 kelevra 594 Вчера, 16:40
автор: phoenix_kys
Открытая тема (нет новых ответов) Как действительно успешно внедрять привычки. И менять жизнь
seoandme.ru - SEO-блог Анны Ященко
13 AnnaYa 1252 Вчера, 16:23
автор: Zoya83
Открытая тема (нет новых ответов) Facebook палит прокси. Кто как решает эту проблему?
26 Twickbot 3416 Вчера, 15:02
автор: Mikki


 



RSS Текстовая версия Сейчас: 14.12.2017, 8:47
Дизайн